ARHGAP8 antibody
| Name | ARHGAP8 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA337735 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rat |
| Antigen | The immunogen for anti-ARHGAP8 antibody is: synthetic peptide directed towards the middle region of Human ARHGAP8. Synthetic peptide located within the following region: PRPPLPTQQFGVSLQYLKDKNQGELIPPVLRFTVTYLREKGLRTEGLFRR. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | ARHGAP8 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-ARHGAP8 Antibody; Titration: 1.0 ug/ml; Positive Control: 293T Whole Cell ARHGAP8 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells