ARHGAP11B antibody
| Name | ARHGAP11B antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA334130 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for Anti-ARHGAP11B Antibody is: synthetic peptide directed towards the C-terminal region of Human ARHGAP11B. Synthetic peptide located within the following region: MDSSNLAVIFAPNLLQTSEGHEKMSSNAEKKGVYQTLSWKRYQPCWVLMV. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | ARHGAP11B |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: ARHGAP11B; Sample Tissue: Fetal Heart lysates; Antibody Dilution: 1.0 ug/ml.