ARHGEF37 antibody
| Name | ARHGEF37 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA334895 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for anti-ARHGEF37 antibody is: synthetic peptide directed towards the C-terminal region of Human ARHGEF37. Synthetic peptide located within the following region: VIAAYPFVARSSHEVSLQAGQPVTILEAQDKKGNPEWSLVEVNGQRGYVP. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | ARHGEF37 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: ARHGEF37; Sample Tissue: THP-1 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml