ARL9 antibody

Name ARL9 antibody
Supplier Acris Antibodies
Catalog TA343237
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Antigen The immunogen for anti-Arl9 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Arl9. Synthetic peptide located within the following region: EMYLPKGWLLIFVVDSADHKRLPEAKKYLHQLINPNPGLPLVVFANKQVF.
Description Rabbit Polyclonal
Gene ARL9
Supplier Page Shop

Product images