Name | ARL13A antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA334905 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Horse, Human, Mouse, Pig, Rabbit, Rat |
Antigen | The immunogen for anti-ARL13A antibody is: synthetic peptide directed towards the middle region of Human ARL13A. Synthetic peptide located within the following region: LTHLLSDKRVAGKPILILANKQDKKKALMPCDIIDYLLLKKLVKENKCPC. |
Purity/Format | Affinity Purified |
Description | Rabbit Polyclonal |
Gene | ARL13A |
Supplier Page | Shop |