ARL13A antibody
| Name | ARL13A antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA334905 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Horse, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for anti-ARL13A antibody is: synthetic peptide directed towards the middle region of Human ARL13A. Synthetic peptide located within the following region: LTHLLSDKRVAGKPILILANKQDKKKALMPCDIIDYLLLKKLVKENKCPC. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | ARL13A |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: ARL13A; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0 ug/ml