ATP1B4 antibody
| Name | ATP1B4 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA341890 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat |
| Antigen | The immunogen for anti-ATP1B4 antibody: synthetic peptide directed towards the middle region of human ATP1B4. Synthetic peptide located within the following region: ACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDPVKVS. |
| Description | Rabbit Polyclonal |
| Gene | ATP1B4 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-ATP1B4 Antibody Titration: 0.2-1 ug/ml; Positive Control: COLO205 cell lysate