ATP5SL antibody
| Name | ATP5SL antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330665 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Guinea Pig, Human, Rabbit |
| Antigen | The immunogen for Anti-ATP5SL antibody is: synthetic peptide directed towards the C-terminal region of Human ATP5SL. Synthetic peptide located within the following region: ISDLPAVSNPGLTQILVEEMLPNCEVVGVDWAEGLKSGPEEQPRDTASPV. |
| Description | Rabbit Polyclonal |
| Gene | ATP5SL |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: ATP5SL; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0ug/ml