B3GAT2 antibody
| Name | B3GAT2 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA342092 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat |
| Antigen | The immunogen for anti-B3gat2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SDFLKQITTVEELEPKASNCTKVLVWHTRTEKVNLANEPKYHLDTVNIEV. |
| Description | Rabbit Polyclonal |
| Gene | B3gat2 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-B3gat2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Mouse Brain