B4GALNT2 antibody
| Name | B4GALNT2 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA333466 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-B4GALNT2 Antibody is: synthetic peptide directed towards the N-terminal region of Human B4GALNT2. Synthetic peptide located within the following region: FSYDGIWLFPKNQCKCEANKEQGGYNFQDAYGQSDLPAVKARRQAEFEHF. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | B4GALNT2 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: B4GALNT2; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0 ug/ml