B9D2 antibody

Name B9D2 antibody
Supplier Acris Antibodies
Catalog TA331714
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Antigen The immunogen for Anti-B9D2 Antibody is: synthetic peptide directed towards the N-terminal region of Human B9D2. Synthetic peptide located within the following region: SESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFA.
Description Rabbit Polyclonal
Gene B9D2
Supplier Page Shop

Product images