BHLHE23 antibody
| Name | BHLHE23 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA329973 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse |
| Antigen | The immunogen for anti-Bhlhb4 antibody: synthetic peptide directed towards the n terminal of mouse Bhlhb4. Synthetic peptide located within the following region: MAELKSLSGDSYLALSHSYTATGHAYAAARGPETTRGFGASGPGGDLPAA. |
| Description | Rabbit Polyclonal |
| Gene | Bhlhe23 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-Bhlhb4 Antibody Titration: 0.2-1 ug/ml; Positive Control: Mouse Brain