BRF1 / TFIIIB90 antibody
| Name | BRF1 / TFIIIB90 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA329948 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse |
| Antigen | The immunogen for anti-BRF1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PALGAEPIKPSAVLVESGPVSYHPEEDADEEDAEDEDGEPCVSALQMMGG. |
| Description | Rabbit Polyclonal |
| Gene | Brf1 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-BRF1 Antibody Titration: 1.25ug/ml; ELISA Titer: 1:62500; Positive Control: NIH/3T3 cell lysate