Brorin / VWC2 antibody

Name Brorin / VWC2 antibody
Supplier Acris Antibodies
Catalog TA331518
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Antigen The immunogen for Anti-VWC2 Antibody is: synthetic peptide directed towards the middle region of Human VWC2. Synthetic peptide located within the following region: YVYPDYRGKGCVDESGFVYAIGEKFAPGPSACPCLCTEEGPLCAQPECPR.
Description Rabbit Polyclonal
Gene VWC2
Supplier Page Shop

Product images