BXDC5 / RPF1 antibody
| Name | BXDC5 / RPF1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA343936 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast |
| Antigen | The immunogen for anti-BXDC5 antibody: synthetic peptide directed towards the N terminal of human BXDC5. Synthetic peptide located within the following region: AAAFPPGFSISEIKNKQRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGD. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | RPF1 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-BXDC5 Antibody Titration: 0.2-1 ug/ml; Positive Control: K562 cell lysate