C1orf210 / TEMP antibody
| Name | C1orf210 / TEMP antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA334787 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Human |
| Antigen | The immunogen for anti-C1orf210 antibody is: synthetic peptide directed towards the middle region of Human C1orf210. Synthetic peptide located within the following region: VVLSLLIALAAKCHLCRRYHASYRHRPLPETGRGGRPQVAEDEDDDGFIE. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | C1orf210 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: C1orf210; Sample Tissue: Fetal Kidney lysates; Antibody Dilution: 1.0 ug/ml