C1orf228 antibody

Name C1orf228 antibody
Supplier Acris Antibodies
Catalog TA334858
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Rabbit, Rat
Antigen The immunogen for anti-C1orf228 antibody is: synthetic peptide directed towards the N-terminal region of Human C1orf228. Synthetic peptide located within the following region: LSAVSSNRYLIEFLEVGGVLTLLEILGLEKIKEEAKKESVKLLQVIANSG.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene C1orf228
Supplier Page Shop

Product images