C2orf71 antibody
| Name | C2orf71 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331376 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Guinea Pig, Human, Rabbit, Zebrafish |
| Antigen | The immunogen for Anti-C2orf71 antibody is: synthetic peptide directed towards the C-terminal region of Human C2orf71. Synthetic peptide located within the following region: SPCSPELQGGTRRASPPEFCVLGHGLQPEPRTGHIQDKSQPEAQPQQEEV. |
| Description | Rabbit Polyclonal |
| Gene | C2orf71 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-C2orf71 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal kidney