C3orf36 antibody
| Name | C3orf36 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330763 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-C3orf36 antibody is: synthetic peptide directed towards the C-terminal region of Human C3orf36. Synthetic peptide located within the following region: ALSGRGGGRCSIPSLSSSSTFSLFSSGCWNPRVKLRVRKSQSQGRAGQLI. |
| Description | Rabbit Polyclonal |
| Gene | C3orf36 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: C3orf36; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0ug/mlC3orf36 is supported by BioGPS gene expression data to be expressed in 721_B