C3orf58 / DIA1 antibody
| Name | C3orf58 / DIA1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330958 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Human, Mouse, Rabbit, Rat |
| Antigen | The immunogen for Anti-1190002N15Rik antibody is: synthetic peptide directed towards the N-terminal region of Mouse 1190002N15Rik. Synthetic peptide located within the following region: FLNVKNVYFAQYGEPREGGRRRVVLKRLGSQRELAQLDQSICKRATGRPR. |
| Description | Rabbit Polyclonal |
| Gene | 1190002N15Rik |
| Supplier Page | Shop |
Product images
WB Suggested Anti-1190002N15Rik Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Testis