C3orf62 antibody
| Name | C3orf62 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA333352 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Guinea Pig, Human, Pig |
| Antigen | The immunogen for Anti-C3orf62 Antibody: synthetic peptide directed towards the middle region of human C3orf62. Synthetic peptide located within the following region: IDHTSIRTIEELAGKIEFENELNHMCGHCQDSPFKEEAWALLMDKSPQKA. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | C3orf62 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-C3orf62 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: MCF7 cell lysate