C3orf67 antibody

Name C3orf67 antibody
Supplier Acris Antibodies
Catalog TA339832
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat
Antigen The immunogen for anti-C3orf67 antibody: synthetic peptide directed towards the N terminal of human C3orf67. Synthetic peptide located within the following region: TDIIPRSCQLMTDVPHVTQLLNMTKLRQTEIKFGGHPLRSAESDQFINRG.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene C3orf67
Supplier Page Shop

Product images