C4orf27 antibody
| Name | C4orf27 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330661 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for Anti-C4orf27 antibody is: synthetic peptide directed towards the N-terminal region of Human C4orf27. Synthetic peptide located within the following region: GPQCEKTTDVKKSKFCEADVSSDLRKEVENHYKLSLPEDFYHFWKFCEEL. |
| Description | Rabbit Polyclonal |
| Gene | C4orf27 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: C4orf27; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0ug/mlC4orf27 is supported by BioGPS gene expression data to be expressed in 721_B