C5orf36 antibody
| Name | C5orf36 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331407 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Pig, Rabbit, Rat, Yeast |
| Antigen | The immunogen for anti-C5orf36 antibody: synthetic peptide directed towards the N terminal of human C5orf36. Synthetic peptide located within the following region: CFEWLTNYNYSTSESSFISHGDLIKFFKTLQDLLKNEQNQEEMTLDLLWD. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | KIAA0825 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-C5orf36 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Hela cell lysate