C6orf163 antibody
| Name | C6orf163 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA334808 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Pig, Rabbit |
| Antigen | The immunogen for anti-C6orf163 antibody is: synthetic peptide directed towards the C-terminal region of Human C6orf163. Synthetic peptide located within the following region: FLEEELQETRMAFQKYINYTFPKLSPGHADFILPERKKTPSNLVIKENKT. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | C6orf163 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: C6orf163; Sample Tissue: Jurkat Whole cell lysates; Antibody Dilution: 1.0 ug/ml