C8orf31 antibody

Name C8orf31 antibody
Supplier Acris Antibodies
Catalog TA334854
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen The immunogen for anti-C8orf31 antibody is: synthetic peptide directed towards the N-terminal region of Human C8orf31. Synthetic peptide located within the following region: NSVRQLFKTKQLVTHRDRGSCTHRAQGLLAARTTALQRSPLQQEIWESTT.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene C8orf31
Supplier Page Shop

Product images