C8orf46 antibody

Name C8orf46 antibody
Supplier Acris Antibodies
Catalog TA334828
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Antigen The immunogen for anti-C8orf46 antibody is: synthetic peptide directed towards the C-terminal region of Human C8orf46. Synthetic peptide located within the following region: KKMTEEYPALPQGAEASLPLTGSASCGVPGILRKMWTRHKKKSEYVGATN.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene C8orf46
Supplier Page Shop

Product images