C10orf32 antibody

Name C10orf32 antibody
Supplier Acris Antibodies
Catalog TA333514
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Antigen The immunogen for Anti-C10orf32 Antibody is: synthetic peptide directed towards the C-terminal region of Human C10orf32. Synthetic peptide located within the following region: RNMVLQEDAILHSEDSLRKMAIITTHLQYQQEAIQKNVEQSSDLQDQLNH.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene C10orf32
Supplier Page Shop

Product images