Name | C10orf90 antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA332331 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Guinea Pig, Human, Mouse, Rat |
Antigen | The immunogen for Anti-C10orf90 Antibody is: synthetic peptide directed towards the C-terminal region of Human C10orf90. Synthetic peptide located within the following region: QDVCASLQEDNGVQIESKFPKGDYTCCDLVVKIKECKKSEDPTTPEPSPA. |
Description | Rabbit Polyclonal |
Gene | C10orf90 |
Supplier Page | Shop |