C10orf120 antibody
| Name | C10orf120 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA334906 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-C10orf120 antibody is synthetic peptide directed towards the C-terminal region of Human C10orf120. Synthetic peptide located within the following region: ANQDKKEEAEGKNTKRREIKMNVVFKSKEPKKCLTYHGNDRKSFLPAKKP. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | C10orf120 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: C10orf120; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml