C11orf16 antibody
| Name | C11orf16 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA344774 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-C11orf16 antibody: synthetic peptide directed towards the middle region of human C11orf16. Synthetic peptide located within the following region: EPCLGKPGTRYSNICKEEKDHKQQRAQTAVVGTTKELVSKATHMKPPRTP. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | C11orf16 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-C11orf16 Antibody Titration: 0.2-1 ug/ml; Positive Control: Transfected 293T