C11orf51 antibody
| Name | C11orf51 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331984 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish |
| Antigen | The immunogen for Anti-ANAPC15 Antibody is: synthetic peptide directed towards the N-terminal region of Human ANAPC15. Synthetic peptide located within the following region: EETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDED. |
| Description | Rabbit Polyclonal |
| Gene | ANAPC15 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: ANAPC15; Sample Tissue: HT1080 Whole Cell lysates; Antibody Dilution: 1.0ug/ml