C12orf10 / MYG1 antibody
| Name | C12orf10 / MYG1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331378 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Horse, Human, Rat |
| Antigen | The immunogen for Anti-C12orf10 antibody is: synthetic peptide directed towards the N-terminal region of Human C12orf10. Synthetic peptide located within the following region: PLYTRHRMLGPESVPPPKRSRSKLMAPPRIGTHNGTFHCDEALACALLRL. |
| Description | Rabbit Polyclonal |
| Gene | C12orf10 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-C12orf10 Antibody; Titration: 1.0 ug/ml; Positive Control: 293T Whole CellC12orf10 is supported by BioGPS gene expression data to be expressed in HEK293T