C12orf41 antibody

Name C12orf41 antibody
Supplier Acris Antibodies
Catalog TA330659
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Goat, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Antigen The immunogen for Anti-KANSL2 antibody is: synthetic peptide directed towards the N-terminal region of Human KANSL2. Synthetic peptide located within the following region: CSHPRLEGQEFCIKHILEDKNAPFKQCSYISTKNGKRCPNAAPKPEKKDG.
Description Rabbit Polyclonal
Gene KANSL2
Supplier Page Shop

Product images