C12orf56 antibody
| Name | C12orf56 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA332208 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Horse, Human |
| Antigen | The immunogen for Anti-C12orf56 Antibody is: synthetic peptide directed towards the N-terminal region of Human C12orf56. Synthetic peptide located within the following region: RDVVAIDLIDDYPEFLSSPDREISQHIRIIYSSTVLKKECKKSNSVRKFL. |
| Description | Rabbit Polyclonal |
| Gene | C12orf56 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: C12orf56; Sample Tissue: Fetal Lung lysates; Antibody Dilution: 1.0ug/ml