C12orf56 antibody

Name C12orf56 antibody
Supplier Acris Antibodies
Catalog TA332208
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Horse, Human
Antigen The immunogen for Anti-C12orf56 Antibody is: synthetic peptide directed towards the N-terminal region of Human C12orf56. Synthetic peptide located within the following region: RDVVAIDLIDDYPEFLSSPDREISQHIRIIYSSTVLKKECKKSNSVRKFL.
Description Rabbit Polyclonal
Gene C12orf56
Supplier Page Shop

Product images