C12orf74 antibody
| Name | C12orf74 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA334855 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Horse, Human, Rabbit |
| Antigen | The immunogen for anti-C12orf74 antibody is: synthetic peptide directed towards the N-terminal region of Human C12orf74. Synthetic peptide located within the following region: SPTLRRLRTRGCGTRQDAWQVTTWGSWGAPVGFPCYLSKSLPGSPKDSSH. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | C12orf74 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: C12orf74; Sample Tissue: Hela Whole cell lysates; Antibody Dilution: 1.0 ug/ml