C14orf105 antibody
| Name | C14orf105 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330668 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Horse, Human, Rabbit, Yeast |
| Antigen | The immunogen for Anti-C14orf105 antibody is: synthetic peptide directed towards the C-terminal region of Human C14orf105. Synthetic peptide located within the following region: WKIGKMETWLHEQEAQGQLLWDSSSSDSDEQGKDEKKPRALVRTRTERIP. |
| Description | Rabbit Polyclonal |
| Gene | C14orf105 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: C14orf105; Sample Tissue: HCT15 Whole Cell lysates; Antibody Dilution: 1.0ug/ml