C14orf115 antibody
| Name | C14orf115 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330671 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Human, Pig |
| Antigen | The immunogen for Anti-VRTN antibody is: synthetic peptide directed towards the C-terminal region of Human VRTN. Synthetic peptide located within the following region: GGQEAEEKQEKEAGRDVTAVMAPPVGASSEDVEGGPSREGALQEGATAQG. |
| Description | Rabbit Polyclonal |
| Gene | VRTN |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: VRTN; Sample Tissue: NCI-H226 Whole Cell lysates; Antibody Dilution: 1.0ug/mlVRTN is supported by BioGPS gene expression data to be expressed in NCIH226