C14orf142 antibody
| Name | C14orf142 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA333612 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Mouse, Pig, Rat |
| Antigen | The immunogen for Anti-C14orf142 Antibody is: synthetic peptide directed towards the C-terminal region of Human C14orf142. Synthetic peptide located within the following region: LVQGEVQHRVAAAPDEDLDGDDEDDAEDENNIDNRTNFDGPSAKRPKTPS. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | C14orf142 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: C14orf142; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0 ug/ml.