C14orf166B antibody
| Name | C14orf166B antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA333377 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Guinea Pig, Human |
| Antigen | The immunogen for Anti-C14orf166B Antibody is: synthetic peptide directed towards the N-terminal region of Human C14orf166B. Synthetic peptide located within the following region: GMPPDEIEIEPVRQSSDKMLYCEAESPPTVEKVKPARENSETDLEIEDDE. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | LRRC74A |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: C14orf166B; Sample Tissue: Fetal Heart lysates; Antibody Dilution: 1.0 ug/ml.