C15orf26 antibody
| Name | C15orf26 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA337776 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Human, Rabbit |
| Antigen | The immunogen for anti-C15orf26 antibody is: synthetic peptide directed towards the middle region of Human C15orf26. Synthetic peptide located within the following region: LCMTPDEIQSHLKDELEVPCGLSAVQAKTPIGRNTFIILSVHRDATGQVL. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | C15orf26 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: C15orf26; Sample Tissue: Esophagus Tumor lysates; Antibody Dilution: 1.0 ug/ml