C16orf46 antibody
| Name | C16orf46 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA338820 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-C16orf46 antibody: synthetic peptide directed towards the N terminal of human C16orf46. Synthetic peptide located within the following region: LSHWSLQTKPPTEGGPEKDQSSPSQTQAAPQGPSTASRAISDICFPTYFR. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | C16orf46 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-C16orf46 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human brain