C16orf93 antibody
| Name | C16orf93 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA334141 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Horse, Guinea Pig, Human, Pig, Rat |
| Antigen | The immunogen for Anti-C16orf93 Antibody is: synthetic peptide directed towards the C-terminal region of Human C16orf93. Synthetic peptide located within the following region: ETVAPPEPEPSHIHVLRAYIKTQVNKELEQLQGLVEERLKASEERLSSKL. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | C16orf93 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: C16orf93; Sample Tissue: Fetal Brain lysates; Antibody Dilution: 1.0 ug/ml.