C17orf48 antibody
| Name | C17orf48 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA344800 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-C17orf48 antibody: synthetic peptide directed towards the N terminal of human C17orf48. Synthetic peptide located within the following region: MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLL. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | ADPRM |
| Supplier Page | Shop |
Product images
WB Suggested Anti-C17orf48 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate