C17orf89 antibody
| Name | C17orf89 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA334846 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Human, Mouse, Rat |
| Antigen | The immunogen for anti-C17orf89 antibody is: synthetic peptide directed towards the N-terminal region of Human C17orf89. Synthetic peptide located within the following region: VWGRVRSRLRAFPERLAACGAEAAAYGRCVQASTAPGGRLSKDFCAREFE. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | C17orf89 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: C17orf89; Sample Tissue: Fetal Lung lysates; Antibody Dilution: 1.0 ug/ml