C18orf32 antibody
| Name | C18orf32 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA336020 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-C18orf32 Antibody: synthetic peptide directed towards the middle region of human C18orf32. Synthetic peptide located within the following region: PLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDKKK. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | C18orf32 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-C18orf32 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate