C19orf44 antibody
| Name | C19orf44 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA333619 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-C19orf44 Antibody is: synthetic peptide directed towards the N-terminal region of Human C19orf44. Synthetic peptide located within the following region: EAPAGKERTLQTPKQKEPARTFDSPDSDEEEMKVLLGSLMDSSREKNTNQ. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | C19orf44 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: C19orf44; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0 ug/ml.