C19orf56 antibody
| Name | C19orf56 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA341999 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for anti-C19orf56 antibody: synthetic peptide directed towards the N terminal of human C19orf56. Synthetic peptide located within the following region: STNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLML. |
| Description | Rabbit Polyclonal |
| Gene | WDR83OS |
| Supplier Page | Shop |
Product images
WB Suggested Anti-C19orf56 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 721_B cell lysate.WDR83OS is supported by BioGPS gene expression data to be expressed in 721_B