C19orf57 antibody
| Name | C19orf57 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330731 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-C19orf57 antibody is: synthetic peptide directed towards the N-terminal region of Human C19orf57. Synthetic peptide located within the following region: VPSTQQHGEEPGKAVSSSPDEETGSPCRLLRQPEKEPAPLPPSQNSFGRF. |
| Description | Rabbit Polyclonal |
| Gene | C19orf57 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: C19orf57; Sample Tissue: RPMI-8226 Whole Cell lysates; Antibody Dilution: 1.0ug/ml