C19orf66 antibody

Name C19orf66 antibody
Supplier Acris Antibodies
Catalog TA330678
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Antigen The immunogen for Anti-C19orf66 antibody is: synthetic peptide directed towards the N-terminal region of Human C19orf66. Synthetic peptide located within the following region: FGSDHTGVGRSIVYGVKQKDGQELSNDLDAQDPPEDMKQDRDIQAVATSL.
Description Rabbit Polyclonal
Gene C19orf66
Supplier Page Shop

Product images