C20orf24 / RIP5 antibody
| Name | C20orf24 / RIP5 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331052 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast |
| Antigen | The immunogen for anti-C20orf24 antibody: synthetic peptide directed towards the N terminal of human C20orf24. Synthetic peptide located within the following region: MSGGRRKEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDEFLDVIYWFRQ. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | C20orf24 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-C20orf24 Antibody Titration: 2.5ug/ml; Positive Control: Jurkat cell lysate